Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHC2 Peptide - C-terminal region

PHC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHC2, EDR2, PH2

UniProt

Q8IXK0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHC2 Rabbit Polyclonal Antibody (orb581318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GMTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF207 Rabbit Polyclonal Antibody
TA333996 100 µL

ZNF207 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SGK Antibody
E18-6001-1 50 µg - 50 µL

SGK Antibody

Sign In for Pricing
View Details
Bovine Small nuclear ribonucleoprotein G, SNRPG ELISA Kit
MBS9324812-01 48 Well

Bovine Small nuclear ribonucleoprotein G, SNRPG ELISA Kit

Sign In for Pricing
View Details
Bovine Small nuclear ribonucleoprotein G, SNRPG ELISA Kit
MBS9324812-02 96 Well

Bovine Small nuclear ribonucleoprotein G, SNRPG ELISA Kit

Sign In for Pricing
View Details
Bovine Small nuclear ribonucleoprotein G, SNRPG ELISA Kit
MBS9324812-03 5x 96 Well

Bovine Small nuclear ribonucleoprotein G, SNRPG ELISA Kit

Sign In for Pricing
View Details
Bovine Small nuclear ribonucleoprotein G, SNRPG ELISA Kit
MBS9324812-04 10x 96 Well

Bovine Small nuclear ribonucleoprotein G, SNRPG ELISA Kit

Sign In for Pricing
View Details