Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHC2 Peptide - C-terminal region

PHC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHC2, EDR2, PH2

UniProt

Q8IXK0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHC2 Rabbit Polyclonal Antibody (orb581318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GMTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Procalcitonin (PCT) Mouse mAb, Cy5 conjugated
orb2821698 100 µL

Procalcitonin (PCT) Mouse mAb, Cy5 conjugated

Sign In for Pricing
View Details
EIF2Bγ (P-5)
sc-9980 200 µg/mL

EIF2Bγ (P-5)

Sign In for Pricing
View Details
Oil Red O
OD0395 50g

Oil Red O

Sign In for Pricing
View Details
mmu-miR-152-5p miRNA Agomir
MBS8314124-01 5 nmol

mmu-miR-152-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-152-5p miRNA Agomir
MBS8314124-02 10 nmol

mmu-miR-152-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-152-5p miRNA Agomir
MBS8314124-03 20 nmol

mmu-miR-152-5p miRNA Agomir

Sign In for Pricing
View Details