What is the catalog number for TTLL5 Peptide - C-terminal region?

The catalog number for TTLL5 Peptide - C-terminal region is orb2002081.

What sizes are available for TTLL5 Peptide - C-terminal region?

TTLL5 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is TTLL5 Peptide - C-terminal region in stock?

TTLL5 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TTLL5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TTLL5, KIAA0998, STAMP

UniProt

Q6EMB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055887

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISPSGPTWSTQSDPQAPENHSSSPGSRSLQTGGFAWEGEVENNVYSQATG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E40KMH1668 20 µg

Recombinant Human SCF/KITLG Protein, No Tag

Sign In for Pricing

View Details

TRC-D447440-10MG 10 mg

3Alpha,12Beta-Dihydroxycholanoic Acid

Sign In for Pricing

View Details

GTR15413525 1 Vial

Human UFL1 Knockout A549 cell line

Sign In for Pricing

View Details

LS222194-20ug 20 µg

RSBN1L (NM_198467) Human Over-expression Lysate

Sign In for Pricing

View Details

ABS-375-1mg 1 mg

Spesolimab Biosimilar, Research Grade

Sign In for Pricing

View Details

E51P01320 100 µg

DLK1 Protein, Mouse, Recombinant (C-His)

Sign In for Pricing

View Details