Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD15 Peptide - N-terminal region

SAMD15 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FAM15A, C14orf174

UniProt

Q9P1V8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAMD15 Rabbit Polyclonal Antibody (orb325691) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001010860

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEDYDSGPDEDGELEPERPELPGLHKLYENAEPDTMAKADSKLPAEIYQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (DF-B1), CF640R conjugate, 0.1mg/mL
BNC401066-100 1x 100 µL

CD45RB (DF-B1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CWF19L1 activation kit by CRISPRa
GA110668 1 Kit

Human CWF19L1 activation kit by CRISPRa

Sign In for Pricing
View Details
TGFalpha (TGFA/1119), CF640R conjugate, 0.1mg/mL
BNC401119-500 1x 500 µL

TGFalpha (TGFA/1119), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRBV5-4 antibody
FNab08957 100 µg

TRBV5-4 antibody

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD62L Antibody[DREG56]
E-AB-F1051M-01 20 Tests

Elab Fluor® 647 Anti-Human CD62L Antibody[DREG56]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD62L Antibody[DREG56]
E-AB-F1051M-02 100 Tests

Elab Fluor® 647 Anti-Human CD62L Antibody[DREG56]

Sign In for Pricing
View Details