SAMD15 Peptide - N-terminal region
SAMD15 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FAM15A, C14orf174
UniProt
Q9P1V8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SAMD15 Rabbit Polyclonal Antibody (orb325691) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001010860
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PEDYDSGPDEDGELEPERPELPGLHKLYENAEPDTMAKADSKLPAEIYQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741074-500 1x 500 µL
SOX10 (SOX10/991 + SOX10/1074), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 