Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYL6B Peptide - middle region

MYL6B Peptide - middle region

Product Specifications

Product Name Alternative

MYL6B, MLC1SA

UniProt

P14649

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYL6B Rabbit Polyclonal Antibody (orb581534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002466

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamyl Prolyl tRNA Synthetase (EPRS) Antibody
abx338551-01 20 µg

Glutamyl Prolyl tRNA Synthetase (EPRS) Antibody

Sign In for Pricing
View Details
Glutamyl Prolyl tRNA Synthetase (EPRS) Antibody
abx338551-02 50 µg

Glutamyl Prolyl tRNA Synthetase (EPRS) Antibody

Sign In for Pricing
View Details
Glutamyl Prolyl tRNA Synthetase (EPRS) Antibody
abx338551-03 100 µg

Glutamyl Prolyl tRNA Synthetase (EPRS) Antibody

Sign In for Pricing
View Details
Glutamyl Prolyl tRNA Synthetase (EPRS) Antibody
abx338551-04 200 µg

Glutamyl Prolyl tRNA Synthetase (EPRS) Antibody

Sign In for Pricing
View Details
Glutamyl Prolyl tRNA Synthetase (EPRS) Antibody
abx338551-05 1 mg

Glutamyl Prolyl tRNA Synthetase (EPRS) Antibody

Sign In for Pricing
View Details
C19orf53 Lentiviral Activation Particles (h2)
sc-408404-LAC-2 200 µL

C19orf53 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details