Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYL6B Peptide - middle region

MYL6B Peptide - middle region

Product Specifications

Product Name Alternative

MYL6B, MLC1SA

UniProt

P14649

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYL6B Rabbit Polyclonal Antibody (orb581534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002466

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSM705 hydrochloride
T62550-01 25 mg

DSM705 hydrochloride

Sign In for Pricing
View Details
DSM705 hydrochloride
T62550-02 50 mg

DSM705 hydrochloride

Sign In for Pricing
View Details
DSM705 hydrochloride
T62550-03 100 mg

DSM705 hydrochloride

Sign In for Pricing
View Details
IL13 Recombinant Protein
OPCD04261-10UG 10 µg

IL13 Recombinant Protein

Sign In for Pricing
View Details
Mouse PLA2G10 shRNA Plasmid
abx973749-01 150 µg

Mouse PLA2G10 shRNA Plasmid

Sign In for Pricing
View Details
Mouse PLA2G10 shRNA Plasmid
abx973749-02 300 µg

Mouse PLA2G10 shRNA Plasmid

Sign In for Pricing
View Details