NOXA1 Peptide - middle region
NOXA1 Peptide - middle region
Product Specifications
Product Name Alternative
NOXA1, P51NOX
UniProt
Q86UR1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NOXA1 Rabbit Polyclonal Antibody (orb581622) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006638
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
038269-Biotin 200 µL
MCF2, CT (MCF2, DBL, Proto-oncogene DBL, Proto-oncogene MCF-2, MCF2-transforming protein, DBL-transforming protein) (Biotin) discontinued
Sign In for Pricing
View Details 
123048-HRP 100 µL
Fetoprotein, Alpha (AFP, Alpha1-fetoprotein, Alpha-fetoglobulin, Alpha-fetoprotein precursor, FETA, HPAFP) (HRP)
Sign In for Pricing
View Details PA1957-iFluor647 100 µg
Anti-Tight junction protein ZO-2 TJP2 Antibody Picoband®, iFluor647 Conjugate
Sign In for Pricing
View Details MBS6168495-01 0.1 mL
NUDC (Nuclear Distribution Gene C Homolog (A. nidulans), HNUDC, MNUDC, NPD011) (APC)
Sign In for Pricing
View Details MBS6168495-02 5x 0.1 mL
NUDC (Nuclear Distribution Gene C Homolog (A. nidulans), HNUDC, MNUDC, NPD011) (APC)
Sign In for Pricing
View Details 