Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOXA1 Peptide - middle region

NOXA1 Peptide - middle region

Product Specifications

Product Name Alternative

NOXA1, P51NOX

UniProt

Q86UR1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOXA1 Rabbit Polyclonal Antibody (orb581622) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006638

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SAPS1 Rabbit pAb
GB114170-100 100 μL

Anti-SAPS1 Rabbit pAb

Sign In for Pricing
View Details
Carboxypeptidase A2 (CPA2) Rat ELISA Kit
C1337 96 Tests

Carboxypeptidase A2 (CPA2) Rat ELISA Kit

Sign In for Pricing
View Details
Goat anti-Rabbit IgG (H&L), HRP conjugated - trial sample
AS09 602-trial 10 µL

Goat anti-Rabbit IgG (H&L), HRP conjugated - trial sample

Sign In for Pricing
View Details
Mycophenolic acid-13C, d3
SL1070-1 1 mg

Mycophenolic acid-13C, d3

Sign In for Pricing
View Details
BNP (1-32), rat TFA (133448-20-1 free base)
TP1209-01 1 mg

BNP (1-32), rat TFA (133448-20-1 free base)

Sign In for Pricing
View Details
BNP (1-32), rat TFA (133448-20-1 free base)
TP1209-02 5 mg

BNP (1-32), rat TFA (133448-20-1 free base)

Sign In for Pricing
View Details