Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CGAS Peptide - C-terminal region

CGAS Peptide - C-terminal region

Product Specifications

Product Name Alternative

MB21D1, C6orf150

UniProt

Q8N884

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CGAS Rabbit Polyclonal Antibody (orb581770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_612450

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PASTQEGLRIQNWLSAKVRKQLRLKPFYLVPKHAKEGNGFQEETWRLSFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF583 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E2]
TA810557BM 100 µL

ZNF583 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E2]

Sign In for Pricing
View Details
MIR3914-1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV768551 1.0 µg DNA

MIR3914-1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
(S, S, S) -Triglycidyl Isocyanurate
OR1078150 1 g

(S, S, S) -Triglycidyl Isocyanurate

Sign In for Pricing
View Details
Syntabulin (SYBU) (NM_001099756) Human Over-expression Lysate
LS055638-100ug 100 µg

Syntabulin (SYBU) (NM_001099756) Human Over-expression Lysate

Sign In for Pricing
View Details
Taxiphyllin
orb1681592 1 mg

Taxiphyllin

Sign In for Pricing
View Details
CCDC75 Adenovirus (Mouse)
15305054 1.0 mL

CCDC75 Adenovirus (Mouse)

Sign In for Pricing
View Details