Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CGAS Peptide - C-terminal region

CGAS Peptide - C-terminal region

Product Specifications

Product Name Alternative

MB21D1, C6orf150

UniProt

Q8N884

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CGAS Rabbit Polyclonal Antibody (orb581770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_612450

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PASTQEGLRIQNWLSAKVRKQLRLKPFYLVPKHAKEGNGFQEETWRLSFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Phenylalanine ELISA Kit
GTR10324272 96 Well

Guinea Pig Phenylalanine ELISA Kit

Sign In for Pricing
View Details
[4-[2- (Dimethylamino) ethoxy]phenyl]methanol
orb3031156-01 100 mg

[4-[2- (Dimethylamino) ethoxy]phenyl]methanol

Sign In for Pricing
View Details
[4-[2- (Dimethylamino) ethoxy]phenyl]methanol
orb3031156-02 2 mg

[4-[2- (Dimethylamino) ethoxy]phenyl]methanol

Sign In for Pricing
View Details
[4-[2- (Dimethylamino) ethoxy]phenyl]methanol
orb3031156-03 10 mg

[4-[2- (Dimethylamino) ethoxy]phenyl]methanol

Sign In for Pricing
View Details
Mouse Monoclonal KCTD15 Antibody (AT4C3) [DyLight 594]
NBP1-49429DL594 0.1 mL

Mouse Monoclonal KCTD15 Antibody (AT4C3) [DyLight 594]

Sign In for Pricing
View Details
1,2-Dimethyl-1H-imidazole-4-carboxylic acid
OR1002938-01 100 mg

1,2-Dimethyl-1H-imidazole-4-carboxylic acid

Sign In for Pricing
View Details