Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICA1L Peptide - middle region

ICA1L Peptide - middle region

Product Specifications

Product Name Alternative

ICA1L, ALS2CR14, ALS2CR15

UniProt

Q8NDH6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ICA1L Rabbit Polyclonal Antibody (orb325756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_612477

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKMDVCQKVDLLGASRCNMLSHSLTTYQRTLLGFWKKTARMMSQIHEACI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Ras-Related Protein Rab-20 (RAB20) ELISA Kit
MBS9931480-01 48 Well

Bovine Ras-Related Protein Rab-20 (RAB20) ELISA Kit

Sign In for Pricing
View Details
Bovine Ras-Related Protein Rab-20 (RAB20) ELISA Kit
MBS9931480-02 96 Well

Bovine Ras-Related Protein Rab-20 (RAB20) ELISA Kit

Sign In for Pricing
View Details
Bovine Ras-Related Protein Rab-20 (RAB20) ELISA Kit
MBS9931480-03 5x 96 Well

Bovine Ras-Related Protein Rab-20 (RAB20) ELISA Kit

Sign In for Pricing
View Details
Bovine Ras-Related Protein Rab-20 (RAB20) ELISA Kit
MBS9931480-04 10x 96 Well

Bovine Ras-Related Protein Rab-20 (RAB20) ELISA Kit

Sign In for Pricing
View Details
Bcl-2 Antibody
orb1712672 1 mL

Bcl-2 Antibody

Sign In for Pricing
View Details
ZNF771 rabbit pAb Antibody
orb766618-01 50 μL

ZNF771 rabbit pAb Antibody

Sign In for Pricing
View Details