Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICA1L Peptide - middle region

ICA1L Peptide - middle region

Product Specifications

Product Name Alternative

ICA1L, ALS2CR14, ALS2CR15

UniProt

Q8NDH6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ICA1L Rabbit Polyclonal Antibody (orb325756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_612477

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKMDVCQKVDLLGASRCNMLSHSLTTYQRTLLGFWKKTARMMSQIHEACI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2 (H2-M5) (NM_001115075) Mouse Tagged Lenti ORF Clone
MR225669L3 10 µg

H2 (H2-M5) (NM_001115075) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Pyruvic Acid Potassium Salt
41600006-2 100 g

Pyruvic Acid Potassium Salt

Sign In for Pricing
View Details
Supt7l-set siRNA/shRNA/RNAi Lentivector (Rat)
45897096 4x 500 ng

Supt7l-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Leucine-zipper-Like Transcriptional regulator 1 (LZTR1) Human ELISA Kit
E6673 96 Tests

Leucine-zipper-Like Transcriptional regulator 1 (LZTR1) Human ELISA Kit

Sign In for Pricing
View Details
(2- (1- (3,5-Bis (Trifluoromethyl) Benzyl) -5- (Pyridin-4-Yl) -1H-1,2,3-Triazol-4-Yl) Pyridin-3-Yl) (2-Chlorophenyl) Methanone
PC108634 50 mg

(2- (1- (3,5-Bis (Trifluoromethyl) Benzyl) -5- (Pyridin-4-Yl) -1H-1,2,3-Triazol-4-Yl) Pyridin-3-Yl) (2-Chlorophenyl) Methanone

Sign In for Pricing
View Details
Stearic Acid discontinued. See 289067
166601 25 g

Stearic Acid discontinued. See 289067

Sign In for Pricing
View Details