Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDR9C7 Peptide - C-terminal region

SDR9C7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RDHS, SDRO, SDR-O, ARCI13

UniProt

Q8NEX9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SDR9C7 Rabbit Polyclonal Antibody (orb325793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_683695

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIEPGNYRTAILGKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9-Decyn-1-ol (94%)
TRC-D352100-500MG 500 mg

9-Decyn-1-ol (94%)

Sign In for Pricing
View Details
Dacomitinib
TRC-D101575-5MG 5 mg

Dacomitinib

Sign In for Pricing
View Details
HRP Conjugated Mouse anti Goat IgG heavy chain Mouse Monoclonal Antibody [B7-A3]
M0910-7 100 µL

HRP Conjugated Mouse anti Goat IgG heavy chain Mouse Monoclonal Antibody [B7-A3]

Sign In for Pricing
View Details
2,3-Dichlorobenzoic Acid-13C,d3
TRC-D431951-50MG 50 mg

2,3-Dichlorobenzoic Acid-13C,d3

Sign In for Pricing
View Details
Mammaglobin A Mouse Monoclonal Antibody [A9A2]
HA601088 100 µL

Mammaglobin A Mouse Monoclonal Antibody [A9A2]

Sign In for Pricing
View Details
DPP8 (NM_130434) Human Over-expression Lysate
LY403323 100 µg

DPP8 (NM_130434) Human Over-expression Lysate

Sign In for Pricing
View Details