Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDR9C7 Peptide - C-terminal region

SDR9C7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RDHS, SDRO, SDR-O, ARCI13

UniProt

Q8NEX9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SDR9C7 Rabbit Polyclonal Antibody (orb325793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_683695

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIEPGNYRTAILGKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Interleukin-33/IL-33 Protein (His Tag)
PKSH032642-01 20 µg

Recombinant Human Interleukin-33/IL-33 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Interleukin-33/IL-33 Protein (His Tag)
PKSH032642-02 100 µg

Recombinant Human Interleukin-33/IL-33 Protein (His Tag)

Sign In for Pricing
View Details
Human Albumin (ALB) ELISA Kit
RDR-ALB-Hu-01 96 Tests

Human Albumin (ALB) ELISA Kit

Sign In for Pricing
View Details
Human Albumin (ALB) ELISA Kit
RDR-ALB-Hu-02 48 Tests

Human Albumin (ALB) ELISA Kit

Sign In for Pricing
View Details
2-Chloro-5-(hydrazinocarbonyl)benzenesulfonamide
TRC-C370000-250MG 250 mg

2-Chloro-5-(hydrazinocarbonyl)benzenesulfonamide

Sign In for Pricing
View Details
TDP-25/TDP-35/TDP-43 Antibody
KC-1730-01 50 μL

TDP-25/TDP-35/TDP-43 Antibody

Sign In for Pricing
View Details