GLDC Peptide - C-terminal region
GLDC Peptide - C-terminal region
Product Specifications
Product Name Alternative
GCE, GCSP, HYGN1
UniProt
P23378
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GLDC Rabbit Polyclonal Antibody (orb325905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000161
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742763-100 1x 100 µL
CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2763), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-UNEL-R0067-01 5x 96 Tests
Uncoated Rat bFGF/FGF2 (Basic Fibroblast Growth Factor) ELISA Kit
Sign In for Pricing
View Details E-UNEL-R0067-02 15x 96 Tests
Uncoated Rat bFGF/FGF2 (Basic Fibroblast Growth Factor) ELISA Kit
Sign In for Pricing
View Details 
