GLDC Peptide - C-terminal region
GLDC Peptide - C-terminal region
Product Specifications
Product Name Alternative
GCE, GCSP, HYGN1
UniProt
P23378
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GLDC Rabbit Polyclonal Antibody (orb325905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000161
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-C325040-1MG 1 mg
Chloramphenicol 1-O-Beta-D-Glucuronide Triethylammonium Salt
Sign In for Pricing
View Details 
BNC880890-100 1x 100 µL
NGFR (Nerve Growth Factor Receptor) (NGFR5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC043498-500 1x 500 µL
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3498), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP52467PU-N 400 µL
Lunatic Fringe (LFNG) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details