Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSS Peptide - C-terminal region

GSS Peptide - C-terminal region

Product Specifications

Product Name Alternative

GSHS, HEL-S-64p, HEL-S-88n

UniProt

P48637

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSS Rabbit Polyclonal Antibody (orb325907) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005260463

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQLAGTKKVQQELSRPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urah Mouse shRNA Plasmid (Locus ID 76974)
TL513517 1 Kit

Urah Mouse shRNA Plasmid (Locus ID 76974)

Sign In for Pricing
View Details
Collagen VI alpha 2 Rabbit Polyclonal Antibody (FITC)
orb186964 100 µL

Collagen VI alpha 2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ZNF688 Lentiviral Activation Particles (m2)
sc-427346-LAC-2 200 µL

ZNF688 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Olfactory receptor 51B2 Antibody
G908-01 50 μL

Olfactory receptor 51B2 Antibody

Sign In for Pricing
View Details
Olfactory receptor 51B2 Antibody
G908-02 100 µL

Olfactory receptor 51B2 Antibody

Sign In for Pricing
View Details
Human TMCO3 shRNA Plasmid
abx960394-01 150 µg

Human TMCO3 shRNA Plasmid

Sign In for Pricing
View Details