Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSS Peptide - C-terminal region

GSS Peptide - C-terminal region

Product Specifications

Product Name Alternative

GSHS, HEL-S-64p, HEL-S-88n

UniProt

P48637

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSS Rabbit Polyclonal Antibody (orb325907) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005260463

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQLAGTKKVQQELSRPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cancer/testis antigen 47A (CT47A1) ELISA kit
GTR10431413 96 Well

Mouse Cancer/testis antigen 47A (CT47A1) ELISA kit

Sign In for Pricing
View Details
CHORDC1 (NM_001144073) Human Recombinant Protein
TP327607 20 µg

CHORDC1 (NM_001144073) Human Recombinant Protein

Sign In for Pricing
View Details
LRRK2-IN-5
MBS5805732 Inquire

LRRK2-IN-5

Sign In for Pricing
View Details
Lentiviral mouse Fem1c shRNA (UAS) - Lentiviral mouse Fem1c shRNA (UAS, GFP) plasmid
GTR15211642 1 Vial

Lentiviral mouse Fem1c shRNA (UAS) - Lentiviral mouse Fem1c shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Dolutegravir
S2667-5mg 5 mg

Dolutegravir

Sign In for Pricing
View Details
Fish Ras-Related Protein Rap-1A (RAP1A) ELISA Kit
MBS9360368 Inquire

Fish Ras-Related Protein Rap-1A (RAP1A) ELISA Kit

Sign In for Pricing
View Details