APOC2 Peptide - middle region
APOC2 Peptide - middle region
Product Specifications
Product Name Alternative
APOC2, APC2
UniProt
P02655
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with APOC2 Rabbit Polyclonal Antibody (orb582283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000474
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLK
More Discoveries
Explore Other Products
Browse additional items from our catalog
CSB-YP005877HU-01 20 µg
Recombinant Human Mast cell carboxypeptidase A (CPA3)
Sign In for Pricing
View Details 
CSB-YP005877HU-02 100 µg
Recombinant Human Mast cell carboxypeptidase A (CPA3)
Sign In for Pricing
View Details CSB-YP005877HU-03 1 mg
Recombinant Human Mast cell carboxypeptidase A (CPA3)
Sign In for Pricing
View Details 