CHORDC1 Peptide - N-terminal region
CHORDC1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CHP1
UniProt
Q9UHD1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CHORDC1 Rabbit Polyclonal Antibody (orb325938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_036256
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040146-500 1x 500 µL
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681789-100 1x 100 µL
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details