Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO10 Peptide - C-terminal region

FBXO10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FBX10, PRMT11

UniProt

Q9UK96

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO10 Rabbit Polyclonal Antibody (orb325939) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDTWRLVNPPARPHLENSLRRPSAAHNGQKVTAMATRITARVEGGYHSNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10H-Pyrido[3,2-b][1,4]benzothiazine
TRC-P991655-250MG 250 mg

10H-Pyrido[3,2-b][1,4]benzothiazine

Sign In for Pricing
View Details
Double Beam UV Visible Spectrophotometer BSDBU-202
BSDBU-202 Each

Double Beam UV Visible Spectrophotometer BSDBU-202

Sign In for Pricing
View Details
3’,5’,N2-Tri-O-acetyl 2’-Deoxyguanosine
TRC-T740000-50MG 50 mg

3’,5’,N2-Tri-O-acetyl 2’-Deoxyguanosine

Sign In for Pricing
View Details
Recombinant Mouse EphA6/EHK-2 Protein (Fc Tag)
PKSM040576 200 µg

Recombinant Mouse EphA6/EHK-2 Protein (Fc Tag)

Sign In for Pricing
View Details
TIA1 Rabbit Monoclonal Antibody [Clone ID: 24GB2175]
TA425283 100 µL

TIA1 Rabbit Monoclonal Antibody [Clone ID: 24GB2175]

Sign In for Pricing
View Details
Human KRTAP21-3 activation kit by CRISPRa
GA119230 1 Kit

Human KRTAP21-3 activation kit by CRISPRa

Sign In for Pricing
View Details