FBXO10 Peptide - C-terminal region
FBXO10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FBX10, PRMT11
UniProt
Q9UK96
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FBXO10 Rabbit Polyclonal Antibody (orb325939) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SDTWRLVNPPARPHLENSLRRPSAAHNGQKVTAMATRITARVEGGYHSNR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ICH1043-100mg 100 mg
Anti-Mouse CD8 (YTS-169) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details 
RC-16367-02 100 µL
Recombinant AMPK alpha-2 (phospho S491) Antibody
Sign In for Pricing
View Details 