SND1-IT1 Peptide - N-terminal region
SND1-IT1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
NAG8, NSG-X, C7orf54
UniProt
Q9HBX3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SND1-IT1 Rabbit Polyclonal Antibody (orb325956) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055226
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRNSCLIRMDLLYWQFTIYTITFCFSHLSGRLTLSAQHISHRPCLLSYSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942205-500 1x 500 µL
PGP9.5 / UchL1 (pan-Neuronal Marker) (rUCHL1/775), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470268-500 1x 500 µL
CD3e (T-Cell Marker) (OKT3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details