EPC2 Peptide - C-terminal region
EPC2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
EPC2
UniProt
Q52LR7
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EPC2 Rabbit Polyclonal Antibody (orb582710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_056445
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TSKNGISVTGGITEEQFQTHQQQLVQMQRQQLAQLQQKQQSQHSSQQTHP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472289-100 1x 100 µL
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-CL-H0592-01 24 Tests
Human CXCR3 (Chemokine CXC Receptor 3) CLIA Kit
Sign In for Pricing
View Details