Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPC2 Peptide - C-terminal region

EPC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EPC2

UniProt

Q52LR7

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPC2 Rabbit Polyclonal Antibody (orb582710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056445

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSKNGISVTGGITEEQFQTHQQQLVQMQRQQLAQLQQKQQSQHSSQQTHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP9 Antibody (Biotin)
KB-1699-01 50 μL

MMP9 Antibody (Biotin)

Sign In for Pricing
View Details
MMP9 Antibody (Biotin)
KB-1699-02 100 µL

MMP9 Antibody (Biotin)

Sign In for Pricing
View Details
MMP9 Antibody (Biotin)
KB-1699-03 1 mL

MMP9 Antibody (Biotin)

Sign In for Pricing
View Details
SH3KBP1 Antibody
KC-32858-01 50 μL

SH3KBP1 Antibody

Sign In for Pricing
View Details
SH3KBP1 Antibody
KC-32858-02 100 µL

SH3KBP1 Antibody

Sign In for Pricing
View Details
SH3KBP1 Antibody
KC-32858-03 1 mL

SH3KBP1 Antibody

Sign In for Pricing
View Details