Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB1A Peptide - C-terminal region

RAB1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAB1A, RAB1

UniProt

P62820

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB1A Rabbit Polyclonal Antibody (orb583215) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Growth Hormone (hGH) Antibody
orb24369 1 mg

Human Growth Hormone (hGH) Antibody

Sign In for Pricing
View Details
Horse Toll Interleukin 1 Receptor Domain Containing Adaptor Protein ELISA Kit
MBS081770-01 48 Well

Horse Toll Interleukin 1 Receptor Domain Containing Adaptor Protein ELISA Kit

Sign In for Pricing
View Details
Horse Toll Interleukin 1 Receptor Domain Containing Adaptor Protein ELISA Kit
MBS081770-02 96 Well

Horse Toll Interleukin 1 Receptor Domain Containing Adaptor Protein ELISA Kit

Sign In for Pricing
View Details
Horse Toll Interleukin 1 Receptor Domain Containing Adaptor Protein ELISA Kit
MBS081770-03 5x 96 Well

Horse Toll Interleukin 1 Receptor Domain Containing Adaptor Protein ELISA Kit

Sign In for Pricing
View Details
Horse Toll Interleukin 1 Receptor Domain Containing Adaptor Protein ELISA Kit
MBS081770-04 10x 96 Well

Horse Toll Interleukin 1 Receptor Domain Containing Adaptor Protein ELISA Kit

Sign In for Pricing
View Details
8- (6-Aminohexyl) -amino-adenosine-2',5'-bisphosphate
NU-812L 5x 30 μL

8- (6-Aminohexyl) -amino-adenosine-2',5'-bisphosphate

Sign In for Pricing
View Details