Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB1A Peptide - C-terminal region

RAB1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAB1A, RAB1

UniProt

P62820

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB1A Rabbit Polyclonal Antibody (orb583215) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM4D Polyclonal Antibody
MBS8530996-01 0.1 mg

KDM4D Polyclonal Antibody

Sign In for Pricing
View Details
KDM4D Polyclonal Antibody
MBS8530996-02 0.1 mL (AF635)

KDM4D Polyclonal Antibody

Sign In for Pricing
View Details
KDM4D Polyclonal Antibody
MBS8530996-03 0.1 mL (AF610)

KDM4D Polyclonal Antibody

Sign In for Pricing
View Details
KDM4D Polyclonal Antibody
MBS8530996-04 0.1 mL (AF405S)

KDM4D Polyclonal Antibody

Sign In for Pricing
View Details
KDM4D Polyclonal Antibody
MBS8530996-05 0.1 mL (AF405L)

KDM4D Polyclonal Antibody

Sign In for Pricing
View Details
KDM4D Polyclonal Antibody
MBS8530996-06 0.1 mL (AF546)

KDM4D Polyclonal Antibody

Sign In for Pricing
View Details