CRBN Peptide - N-terminal region
CRBN Peptide - N-terminal region
Product Specifications
Product Name Alternative
CRBN, AD-006
UniProt
Q96SW2
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CRBN Rabbit Polyclonal Antibody (orb583354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_057386
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401146-100 1x 100 µL
CD86 (C86/1146), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details