Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRBN Peptide - middle region

CRBN Peptide - middle region

Product Specifications

Product Name Alternative

CRBN, AD-006

UniProt

Q96SW2

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057386

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PDSS1 Antibody
RC-4613-01 50 μL

Recombinant PDSS1 Antibody

Sign In for Pricing
View Details
Recombinant PDSS1 Antibody
RC-4613-02 100 µL

Recombinant PDSS1 Antibody

Sign In for Pricing
View Details
Recombinant PDSS1 Antibody
RC-4613-03 1 mL

Recombinant PDSS1 Antibody

Sign In for Pricing
View Details
(2R,4S)-Sacubitril-O-isobutane
TRC-S080935-1MG 1 mg

(2R,4S)-Sacubitril-O-isobutane

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benzeneacetonitrile
TRC-B188790-50G 50 g

Benzeneacetonitrile

Sign In for Pricing
View Details