Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRBN Peptide - middle region

CRBN Peptide - middle region

Product Specifications

Product Name Alternative

CRBN, AD-006

UniProt

Q96SW2

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057386

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF2 pThr71/53 Rabbit Polyclonal Antibody
AP02332PU-S 50 µL

ATF2 pThr71/53 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Clec10a Mouse Gene Knockout Kit (CRISPR)
KN503426 1 Kit

Clec10a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/2111), Biotin conjugate, 0.1mg/mL
BNCB2111-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/2111), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF568 conjugate, 0.1mg/mL
BNC683086-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562785 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
RABGGTA (NM_004581) Human Recombinant Protein
TP321822 20 µg

RABGGTA (NM_004581) Human Recombinant Protein

Sign In for Pricing
View Details