Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFAP1 Peptide - N-terminal region

AFAP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AFAP1, AFAP

UniProt

Q8N556

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AFAP1 Rabbit Polyclonal Antibody (orb583609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_940997

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QWLKVIKEAYSGCSGPVDSECPPPPSSPVHKAELEKKLSSERPSSDGEGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGALS1 Antibody
KC-816-01 50 μL

LGALS1 Antibody

Sign In for Pricing
View Details
LGALS1 Antibody
KC-816-02 100 µL

LGALS1 Antibody

Sign In for Pricing
View Details
LGALS1 Antibody
KC-816-03 1 mL

LGALS1 Antibody

Sign In for Pricing
View Details
Sec16a Mouse Gene Knockout Kit (CRISPR)
KN515455 1 Kit

Sec16a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MICA (NM_000247) Human Over-expression Lysate
LC400095 20 µg

MICA (NM_000247) Human Over-expression Lysate

Sign In for Pricing
View Details
Cycloheximide
TRC-C988270-1G 1 g

Cycloheximide

Sign In for Pricing
View Details