AFAP1 Peptide - N-terminal region
AFAP1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AFAP1, AFAP
UniProt
Q8N556
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AFAP1 Rabbit Polyclonal Antibody (orb583609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_940997
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QWLKVIKEAYSGCSGPVDSECPPPPSSPVHKAELEKKLSSERPSSDGEGV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-M0838-01 24 Tests
Mouse NFKB-p65 (Nuclear Factor Kappa B p65) ELISA Kit
Sign In for Pricing
View Details E-EL-M0838-02 48 Tests
Mouse NFKB-p65 (Nuclear Factor Kappa B p65) ELISA Kit
Sign In for Pricing
View Details E-EL-M0838-03 96 Tests
Mouse NFKB-p65 (Nuclear Factor Kappa B p65) ELISA Kit
Sign In for Pricing
View Details 
BNC880777-100 1x 100 µL
Chromogranin A (CHGA/777), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 