Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CST11 Peptide - N-terminal region

CST11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CST11, CST8L

UniProt

Q9H112

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CST11 Rabbit Polyclonal Antibody (orb583997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_570612

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRVLKVQRQVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (HP6053 + L1C1), CF647 conjugate, 0.1mg/mL
BNC470755-100 1x 100 µL

Human Kappa Light Chain (HP6053 + L1C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nck beta (NCK2) (NM_001004720) Human Over-expression Lysate
LY423904 100 µg

Nck beta (NCK2) (NM_001004720) Human Over-expression Lysate

Sign In for Pricing
View Details
Strontium Chloride
TRC-S687678-50G 50 g

Strontium Chloride

Sign In for Pricing
View Details
Polystyrene A Sulfonic Acid
HA2503150430.5G 5 g

Polystyrene A Sulfonic Acid

Sign In for Pricing
View Details
TAF2 (C-term) Rabbit Polyclonal Antibody
AP54144PU-N 400 µL

TAF2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Benzyloxy-2-(1-piperazinyl)pyrimidine
TRC-B287750-2.5MG 2.5 mg

5-Benzyloxy-2-(1-piperazinyl)pyrimidine

Sign In for Pricing
View Details