Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CST11 Peptide - N-terminal region

CST11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CST11, CST8L

UniProt

Q9H112

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CST11 Rabbit Polyclonal Antibody (orb583997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_570612

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRVLKVQRQVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wfdc12 (NM_138684) Mouse Tagged ORF Clone
MG200183 10 µg

Wfdc12 (NM_138684) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CLEC3A Human Gene Knockout Kit (CRISPR)
KN416725 1 Kit

CLEC3A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IPPK Antibody
8C11708-AAT 50 µg

IPPK Antibody

Sign In for Pricing
View Details
MMP15 (NM_002428) Human Over-expression Lysate
LC400870 20 µg

MMP15 (NM_002428) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethyl Nonanoate
TRC-E077675-1G 1 g

Ethyl Nonanoate

Sign In for Pricing
View Details
Alpha-Solanine
TRC-S676503-2.5MG 2.5 mg

Alpha-Solanine

Sign In for Pricing
View Details