Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERHL2 Peptide - C-terminal region

SERHL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DJ222E13.1

UniProt

Q9H4I8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERHL2 Rabbit Polyclonal Antibody (orb326269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055324

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLQRLLKSNSHLSEECGELLLQRGTTKVATGLVLNRDQRLAWAENSIDFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TUBAL3 Knockout A549 cell line
GTR15412278 1 Vial

Human TUBAL3 Knockout A549 cell line

Sign In for Pricing
View Details
pExpress-1-NUBP2 Plasmid
PVT35450 2 µg

pExpress-1-NUBP2 Plasmid

Sign In for Pricing
View Details
Anti-Livin/BIRC7 Antibody Picoband® (PE Conjugate)
RP1081-PE 100 µg/Vial

Anti-Livin/BIRC7 Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
Rat Androsterone,ADT ELISA KIT
JOT-EK1718Ra-01 96 Well

Rat Androsterone,ADT ELISA KIT

Sign In for Pricing
View Details
Rat Androsterone,ADT ELISA KIT
JOT-EK1718Ra-02 48 Well

Rat Androsterone,ADT ELISA KIT

Sign In for Pricing
View Details
DAPT (GSI-IX) 100mg
A10288-100 100 mg

DAPT (GSI-IX) 100mg

Sign In for Pricing
View Details