Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERHL2 Peptide - C-terminal region

SERHL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DJ222E13.1

UniProt

Q9H4I8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERHL2 Rabbit Polyclonal Antibody (orb326269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055324

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLQRLLKSNSHLSEECGELLLQRGTTKVATGLVLNRDQRLAWAENSIDFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASPA Protein Vector (Human) (pPM-N-D-C-His)
PV324421 500 ng

ASPA Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
TSFM Rabbit Monoclonal Antibody
AMRe84803-01 1 Each

TSFM Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TSFM Rabbit Monoclonal Antibody
AMRe84803-02 50 µL

TSFM Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TSFM Rabbit Monoclonal Antibody
AMRe84803-03 100 µL

TSFM Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Proteoglycan 4 (PRG4)
RPU58682-01 50 µg

Recombinant Mouse Proteoglycan 4 (PRG4)

Sign In for Pricing
View Details
Recombinant Mouse Proteoglycan 4 (PRG4)
RPU58682-02 100 µg

Recombinant Mouse Proteoglycan 4 (PRG4)

Sign In for Pricing
View Details