GBA Peptide - N-terminal region
GBA Peptide - N-terminal region
Product Specifications
Product Name Alternative
GCB, GBA1, GLUC
UniProt
P04062
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GBA Rabbit Polyclonal Antibody (orb326390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_006711333
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H2012-E 1 Each
Incu-Shaker™ 10LR with non-slip rubber mat, Refrigerated Shaking Incubator, 230V
Sign In for Pricing
View Details 
![Mouse IL-1 beta Recombinant Rabbit Monoclonal Antibody [PSH03-31] - BSA and Azide free (Capture)](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea816d7/imageurl/ha721976.webp)
HA721976 100 µg
Mouse IL-1 beta Recombinant Rabbit Monoclonal Antibody [PSH03-31] - BSA and Azide free (Capture)
Sign In for Pricing
View Details 
BNCB2075-500 1x 500 µL
MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details