Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBA Peptide - N-terminal region

GBA Peptide - N-terminal region

Product Specifications

Product Name Alternative

GCB, GBA1, GLUC

UniProt

P04062

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GBA Rabbit Polyclonal Antibody (orb326390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006711333

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Interleukin 5 (IL5) ELISA Kit
RD-IL5-p-01 96 Tests

Porcine Interleukin 5 (IL5) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 5 (IL5) ELISA Kit
RD-IL5-p-02 48 Tests

Porcine Interleukin 5 (IL5) ELISA Kit

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (rFLG/1561), CF647 conjugate, 0.1mg/mL
BNC471946-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (rFLG/1561), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fluoro NAD/NADH Detection Kit by Cell Technology
FLNADH100-3 500 Tests

Fluoro NAD/NADH Detection Kit by Cell Technology

Sign In for Pricing
View Details
Rupintrivir
TRC-R701700-2.5MG 2.5 mg

Rupintrivir

Sign In for Pricing
View Details
DLGAP1 Rabbit Polyclonal Antibody
AP06632PU-N 100 µg

DLGAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details