IL13RA1 Peptide - N-terminal region
IL13RA1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
NR4, CT19, CD213A1, IL-13Ra
UniProt
P78552
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL13RA1 Rabbit Polyclonal Antibody (orb326470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001551
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940204-100 1x 100 µL
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680669-100 1x 100 µL
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401927-500 1x 500 µL
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details