What is the catalog number for PTGIR Peptide - C-terminal region?

The catalog number for PTGIR Peptide - C-terminal region is orb2002040.

What sizes are available for PTGIR Peptide - C-terminal region?

PTGIR Peptide - C-terminal region is available in the following size(s): 100 µg.

Is PTGIR Peptide - C-terminal region in stock?

PTGIR Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

PTGIR Peptide - C-terminal region

Product Specifications

Product Name Alternative

IP, PRIPR

UniProt

P43119

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000951

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIFLCNGSVTLSLCRMYRQQKRHQGSLGPRPRTGEDEVDHLILLALMTVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E28PN0947 100 µL

UNC5D Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

HY-RS11419 1 Set

PTPN14 Human Pre-designed siRNA Set A

Sign In for Pricing

View Details

NBP3-27038JF549 0.1 mL

Mouse Monoclonal Siglec-10 Antibody (SIGLEC10/7581) [Janelia Fluor 549]

Sign In for Pricing

View Details

N2175-01K-ML750 100 µL

NSE, phosphorylated (Tyr236) (Gamma-enolase, 2-phospho-D-glycerate Hydro-lyase, Neural Enolase, Neuron-specific Enolase, NSE, Enolase 2, ENO2, NSE) (MaxLight 750) discontinued

Sign In for Pricing

View Details

orb1496286-01 100 µg

Human MOG Protein, His Tag

Sign In for Pricing

View Details

orb1496286-02 1 mg

Human MOG Protein, His Tag

Sign In for Pricing

View Details