TLL1 Peptide - N-terminal region
TLL1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
TLL1, TLL
UniProt
O43897
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TLL1 Rabbit Polyclonal Antibody (orb586023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LVWLVASGIVFYGELWVCAGLDYDYTFDGNEEDKTETIDYKDPCKAAVFW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP13965PU-N 400 µL
AMPK alpha 1 (PRKAA1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
TA361612 100 µL
Poly(A) RNA polymerase, mitochondrial (MTPAP) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
