Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DOA Peptide - N-terminal region

HLA-DOA Peptide - N-terminal region

Product Specifications

Product Name Alternative

HLADZ, HLA-DNA, HLA-DZA

UniProt

P06340

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-DOA Rabbit Polyclonal Antibody (orb326531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002110

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(Phenylthio)acetaldehyde Diethyl Acetal
TRC-P337075-100MG 100 mg

(Phenylthio)acetaldehyde Diethyl Acetal

Sign In for Pricing
View Details
Frozen Tissue Blocks, Liver
CB519650 1 Block

Frozen Tissue Blocks, Liver

Sign In for Pricing
View Details
SCRN3 (NM_001193528) Human Over-expression Lysate
LC434219 20 µg

SCRN3 (NM_001193528) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS808465 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Cox7b2 Mouse Gene Knockout Kit (CRISPR)
KN503733 1 Kit

Cox7b2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Centrin 3 (CETN3) Rabbit Polyclonal Antibody
TA369952 100 µL

Centrin 3 (CETN3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details