HLA-DOA Peptide - N-terminal region
HLA-DOA Peptide - N-terminal region
Product Specifications
Product Name Alternative
HLADZ, HLA-DNA, HLA-DZA
UniProt
P06340
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HLA-DOA Rabbit Polyclonal Antibody (orb326531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_002110
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC422797 20 µg
Sterol carrier protein 2 (SCP2) (NM_001007099) Human Over-expression Lysate
Sign In for Pricing
View Details ![PRMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F9]](https://cdn.genprice.uk/products/937/6868c34d994c49e6dc3f3b37/imageurl/ta503587bm.webp)
TA503587BM 100 µL
PRMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F9]
Sign In for Pricing
View Details 
![CD68 Mouse Monoclonal Antibody [Clone ID: Y1/82A]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fce16/imageurl/am26791rp-n.webp)
AM26791RP-N 100 Tests
CD68 Mouse Monoclonal Antibody [Clone ID: Y1/82A]
Sign In for Pricing
View Details 