PDLIM7 Peptide - middle region
PDLIM7 Peptide - middle region
Product Specifications
Product Name Alternative
LMP1, LMP3
UniProt
Q9NR12
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDLIM7 Rabbit Polyclonal Antibody (orb327252) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSV030317-01 100 µg
Recombinant SARS-CoV-2 Spike RBD (E484K, K417T, N501Y) (His Tag)
Sign In for Pricing
View Details PKSV030317-02 1 mg
Recombinant SARS-CoV-2 Spike RBD (E484K, K417T, N501Y) (His Tag)
Sign In for Pricing
View Details ![Nuclear Factor 1 (NFIA) Mouse Monoclonal Antibody [Clone ID: OTI4G7]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908a9e/imageurl/cf811198.webp)
CF811198 100 µg
Nuclear Factor 1 (NFIA) Mouse Monoclonal Antibody [Clone ID: OTI4G7]
Sign In for Pricing
View Details 
