PDLIM7 Peptide - middle region
PDLIM7 Peptide - middle region
Product Specifications
Product Name Alternative
LMP1, LMP3
UniProt
Q9NR12
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDLIM7 Rabbit Polyclonal Antibody (orb327252) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402707-500 1x 500 µL
Tal1 (TAL1/2707), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880907-500 1x 500 µL
TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 