PTCRA Peptide - C-terminal region
PTCRA Peptide - C-terminal region
Product Specifications
Product Name Alternative
PTCRA
UniProt
Q6ISU1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTCRA Rabbit Polyclonal Antibody (orb327261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-TICAM1-Hu-01 96 Tests
Human Toll Like Receptor Adaptor Molecule 1 (TICAM1) ELISA Kit
Sign In for Pricing
View Details RDR-TICAM1-Hu-02 48 Tests
Human Toll Like Receptor Adaptor Molecule 1 (TICAM1) ELISA Kit
Sign In for Pricing
View Details