Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTCRA Peptide - C-terminal region

PTCRA Peptide - C-terminal region

Product Specifications

Product Name Alternative

PTCRA

UniProt

Q6ISU1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTCRA Rabbit Polyclonal Antibody (orb327261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD117 (C117/370), CF740 conjugate, 0.1mg/mL
BNC740370-100 1x 100 µL

CD117 (C117/370), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5,6-Diamino-2-(2-propoxyphenyl)pyrimidin-4(3H)-one
TRC-D416670-500MG 500 mg

5,6-Diamino-2-(2-propoxyphenyl)pyrimidin-4(3H)-one

Sign In for Pricing
View Details
JMJD6 Recombinant Rabbit monoclonal Antibody
HA751541 100 µL

JMJD6 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human RAB20 activation kit by CRISPRa
GA110851 1 Kit

Human RAB20 activation kit by CRISPRa

Sign In for Pricing
View Details
Staph A Quantified Bacterial DNA Standard
28301 1 Unit

Staph A Quantified Bacterial DNA Standard

Sign In for Pricing
View Details
DOK6 Antibody
8C11230-AAT 50 µg

DOK6 Antibody

Sign In for Pricing
View Details