Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCML1 Peptide - middle region

SCML1 Peptide - middle region

Product Specifications

Product Name Alternative

SCML1

UniProt

Q9UN30

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCML1 Rabbit Polyclonal Antibody (orb588164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006724571

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC theta (Phospho-S695) Rabbit Polyclonal Antibody
orb338830-01 30 µL

PKC theta (Phospho-S695) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PKC theta (Phospho-S695) Rabbit Polyclonal Antibody
orb338830-02 50 μL

PKC theta (Phospho-S695) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PKC theta (Phospho-S695) Rabbit Polyclonal Antibody
orb338830-03 100 µL

PKC theta (Phospho-S695) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PKC theta (Phospho-S695) Rabbit Polyclonal Antibody
orb338830-04 200 µL

PKC theta (Phospho-S695) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4- (Pyridin-2-yl) piperidine-4-carbonitrile
OR78760-01 100 mg

4- (Pyridin-2-yl) piperidine-4-carbonitrile

Sign In for Pricing
View Details
4- (Pyridin-2-yl) piperidine-4-carbonitrile
OR78760-02 250 mg

4- (Pyridin-2-yl) piperidine-4-carbonitrile

Sign In for Pricing
View Details