SCML1 Peptide - middle region
SCML1 Peptide - middle region
Product Specifications
Product Name Alternative
SCML1
UniProt
Q9UN30
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SCML1 Rabbit Polyclonal Antibody (orb588164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_006724571
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LKU600034 96 Tests
2', 5'-Oligoadenylate Synthetase 3 (OAS3) Magnetic Luminex Assay Kit
Sign In for Pricing
View Details 
ELI-22565h 96 Tests
Human Putative WAS protein family homolog 4, WASH4P ELISA KIT
Sign In for Pricing
View Details 
orb3008120-01 20 µg
Recombinant Human TBC1 domain family member 3K (TBC3K), Biotinylated
Sign In for Pricing
View Details orb3008120-02 100 µg
Recombinant Human TBC1 domain family member 3K (TBC3K), Biotinylated
Sign In for Pricing
View Details orb3008120-03 1 mg
Recombinant Human TBC1 domain family member 3K (TBC3K), Biotinylated
Sign In for Pricing
View Details 